SCOPe 2.01: Domain d2wzpe_: 2wzp E:

Lineage for d2wzpe_ (2wzp E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (12 PDB entries)

8. Domain d2wzpe_: 2wzp E: [169730]
   automated match to d1g9ea_

Details for d2wzpe_

PDB Entry: 2wzp, 2.6 Å

PDB Description: structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae

PDB Compounds: (E:) camelid vhh5

SCOPe Domain Sequences for d2wzpe_:

Sequence; same for both SEQRES and ATOM records:

>d2wzpe_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
ss

Timeline for d2wzpe_:

• d2wzpe_ is new in SCOPe 2.01-stable
  
• d2wzpe_ appears in SCOPe 2.02
  
• d2wzpe_ appears in the current release, SCOPe 2.08, called d2wzpe1