Lineage for d2wzpe1 (2wzp E:6-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (149 PDB entries)
  8. 2347761Domain d2wzpe1: 2wzp E:6-123 [169730]
    Other proteins in same PDB: d2wzpd2, d2wzpe2, d2wzpf2, d2wzpj2, d2wzpk2, d2wzpl2
    automated match to d1g9ea_

Details for d2wzpe1

PDB Entry: 2wzp (more details), 2.6 Å

PDB Description: structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
PDB Compounds: (E:) camelid vhh5

SCOPe Domain Sequences for d2wzpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wzpe1 b.1.1.1 (E:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyyadsvk
grftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtvss

SCOPe Domain Coordinates for d2wzpe1:

Click to download the PDB-style file with coordinates for d2wzpe1.
(The format of our PDB-style files is described here.)

Timeline for d2wzpe1: