| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein beta-Lactamase, class A [56606] (16 species) |
| Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (27 PDB entries) |
| Domain d2wyxa_: 2wyx A: [169718] automated match to d1bzaa_ complexed with dod; mutant |
PDB Entry: 2wyx (more details), 2.1 Å
SCOPe Domain Sequences for d2wyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wyxa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
vqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdkh
llnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkvt
afarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlvt
wlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeqk
aenrndilaaaakivt
Timeline for d2wyxa_: