PDB entry 2wyx

View 2wyx on RCSB PDB site
Description: Neutron structure of a class A Beta-lactamase Toho-1 E166A R274N R276N triple mutant
Class: hydrolase
Keywords: toho-1, hydrolase, beta-lactamase, ctx- m-type esbls, neutron structure, antibiotic resistance, extended-spectrum beta-lactamases (esbls)
Deposited on 2009-11-20, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NEUT
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamse toho-1
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (0-255)
      • engineered mutation (136)
      • engineered mutation (242)
      • engineered mutation (244)
    Domains in SCOPe 2.08: d2wyxa_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wyxA (A:)
    vqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdkh
    llnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkvt
    afarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlvt
    wlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeqk
    aenrndilaaaakivt