Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein automated matches [190085] (59 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187188] (4 PDB entries) |
Domain d2wyva_: 2wyv A: [169710] automated match to d1ulud_ complexed with na, nad |
PDB Entry: 2wyv (more details), 1.86 Å
SCOPe Domain Sequences for d2wyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wyva_ c.2.1.2 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg itgevvyvdagyhimgm
Timeline for d2wyva_: