SCOPe 2.07: Domain d2wwna_: 2wwn A:

Lineage for d2wwna_ (2wwn A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (13 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:633] [189541] (4 PDB entries)

8. Domain d2wwna_: 2wwn A: [169668]
   automated match to d1eqwa_
   complexed with azi, mes, zn

Details for d2wwna_

PDB Entry: 2wwn, 2.6 Å

PDB Description: yersinia pseudotuberculosis superoxide dismutase c with bound azide

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wwna_:

Sequence; same for both SEQRES and ATOM records:

>d2wwna_ b.1.8.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
ndkasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscap
gmkdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlks
lsevkqhalmihaggdnysdhpmplggggarmacgvie

Timeline for d2wwna_:

• d2wwna_ first appeared in SCOPe 2.01
  
• d2wwna_ appears in SCOPe 2.06
  
• d2wwna_ appears in the current release, SCOPe 2.08