Lineage for d2wwna_ (2wwn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764458Species Yersinia pseudotuberculosis [TaxId:633] [189541] (4 PDB entries)
  8. 2764465Domain d2wwna_: 2wwn A: [169668]
    automated match to d1eqwa_
    complexed with azi, mes, zn

Details for d2wwna_

PDB Entry: 2wwn (more details), 2.6 Å

PDB Description: yersinia pseudotuberculosis superoxide dismutase c with bound azide
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wwna_ b.1.8.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
ndkasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscap
gmkdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlks
lsevkqhalmihaggdnysdhpmplggggarmacgvie

SCOPe Domain Coordinates for d2wwna_:

Click to download the PDB-style file with coordinates for d2wwna_.
(The format of our PDB-style files is described here.)

Timeline for d2wwna_: