| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein automated matches [190916] (13 species) not a true protein |
| Species Yersinia pseudotuberculosis [TaxId:633] [189541] (4 PDB entries) |
| Domain d2wwna_: 2wwn A: [169668] automated match to d1eqwa_ complexed with azi, mes, zn |
PDB Entry: 2wwn (more details), 2.6 Å
SCOPe Domain Sequences for d2wwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wwna_ b.1.8.1 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 633]}
ndkasmtvkineslpqgngkalgtvtvtetaygllftphltglapgihgfhlhekpscap
gmkdgkavpalaagghldpnktgvhlgpyndkghlgdlpglvvnadgtatypvlaprlks
lsevkqhalmihaggdnysdhpmplggggarmacgvie
Timeline for d2wwna_: