SCOPe 2.08: Domain d2wtxd_: 2wtx D:

Lineage for d2wtxd_ (2wtx D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (2 proteins)
   family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases
   automatically mapped to Pfam PF00982

6. Protein automated matches [191136] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189244] (1 PDB entry)

8. Domain d2wtxd_: 2wtx D: [169624]
   automated match to d1gz5a_
   complexed with edo, udp, vdo

Details for d2wtxd_

PDB Entry: 2wtx, 2.2 Å

PDB Description: insight into the mechanism of enzymatic glycosyltransfer with retention through the synthesis and analysis of bisubstrate glycomimetics of trehalose-6-phosphate synthase

PDB Compounds: (D:) alpha, alpha-trehalose-phosphate synthase [udp-forming]

SCOPe Domain Sequences for d2wtxd_:

Sequence; same for both SEQRES and ATOM records:

>d2wtxd_ c.87.1.6 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivprs

Timeline for d2wtxd_:

• d2wtxd_ first appeared in SCOPe 2.01
  
• d2wtxd_ appears in SCOPe 2.07