![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) ![]() |
![]() | Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (2 proteins) family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases automatically mapped to Pfam PF00982 |
![]() | Protein automated matches [191136] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189244] (1 PDB entry) |
![]() | Domain d2wtxa_: 2wtx A: [198551] automated match to d2wtxd_ complexed with edo, udp, vdo |
PDB Entry: 2wtx (more details), 2.2 Å
SCOPe Domain Sequences for d2wtxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wtxa_ c.87.1.6 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl aerisrhaemldvivkndinhwqecfisdlkqivpr
Timeline for d2wtxa_: