Lineage for d2wtxa_ (2wtx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910914Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (2 proteins)
    family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases
    automatically mapped to Pfam PF00982
  6. 2910925Protein automated matches [191136] (2 species)
    not a true protein
  7. 2910926Species Escherichia coli K-12 [TaxId:83333] [189244] (1 PDB entry)
  8. 2910927Domain d2wtxa_: 2wtx A: [198551]
    automated match to d2wtxd_
    complexed with edo, udp, vdo

Details for d2wtxa_

PDB Entry: 2wtx (more details), 2.2 Å

PDB Description: insight into the mechanism of enzymatic glycosyltransfer with retention through the synthesis and analysis of bisubstrate glycomimetics of trehalose-6-phosphate synthase
PDB Compounds: (A:) alpha, alpha-trehalose-phosphate synthase [udp-forming]

SCOPe Domain Sequences for d2wtxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtxa_ c.87.1.6 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivpr

SCOPe Domain Coordinates for d2wtxa_:

Click to download the PDB-style file with coordinates for d2wtxa_.
(The format of our PDB-style files is described here.)

Timeline for d2wtxa_: