![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein automated matches [190058] (6 species) not a true protein |
![]() | Species Carrot (Daucus carota) [TaxId:4039] [189035] (1 PDB entry) |
![]() | Domain d2wqla_: 2wql A: [169569] automated match to d2bk0a1 complexed with cl, p4c, peg |
PDB Entry: 2wql (more details), 2.7 Å
SCOPe Domain Sequences for d2wqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqla_ d.129.3.1 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]} aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht kgdavvpeenikfadaqntalfkaieaylian
Timeline for d2wqla_: