SCOPe 2.06: Domain d2wqla_: 2wql A:

Lineage for d2wqla_ (2wql A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein automated matches [190058] (6 species)
   not a true protein

7. Species Carrot (Daucus carota) [TaxId:4039] [189035] (1 PDB entry)

8. Domain d2wqla_: 2wql A: [169569]
   automated match to d2bk0a1
   complexed with cl, p4c, peg

Details for d2wqla_

PDB Entry: 2wql, 2.7 Å

PDB Description: crystal structure of the major carrot allergen dau c 1

PDB Compounds: (A:) major allergen dau c 1

SCOPe Domain Sequences for d2wqla_:

Sequence; same for both SEQRES and ATOM records:

>d2wqla_ d.129.3.1 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
kgdavvpeenikfadaqntalfkaieaylian

Timeline for d2wqla_:

• d2wqla_ first appeared in SCOPe 2.01
  
• d2wqla_ appears in SCOPe 2.05
  
• d2wqla_ appears in SCOPe 2.07
  
• d2wqla_ appears in the current release, SCOPe 2.08