PDB entry 2wql

View 2wql on RCSB PDB site
Description: crystal structure of the major carrot allergen dau c 1
Class: allergen
Keywords: pathogenesis-related protein, allergen, plant defense
Deposited on 2009-08-24, released 2009-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • engineered mutation (35)
      • engineered mutation (65)
      • engineered mutation (79)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2wqla_
  • Chain 'B':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • engineered mutation (35)
      • engineered mutation (65)
      • engineered mutation (79)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2wqlb_
  • Chain 'C':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • engineered mutation (35)
      • engineered mutation (65)
      • engineered mutation (79)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2wqlc_
  • Chain 'D':
    Compound: major allergen dau c 1
    Species: DAUCUS CAROTA [TaxId:4039]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04298 (Start-153)
      • engineered mutation (35)
      • engineered mutation (65)
      • engineered mutation (79)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2wqld_
  • Heterogens: P4C, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqlA (A:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqlA (A:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqlB (B:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqlB (B:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wqlC (C:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqlC (C:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wqlD (D:)
    mgaqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpe
    gspittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaif
    htkgdavvpeenikfadaqntalfkaieaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqlD (D:)
    aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
    pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
    kgdavvpeenikfadaqntalfkaieaylian