SCOPe 2.02: Domain d2wnna_: 2wnn A:

Lineage for d2wnna_ (2wnn A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189174] (4 PDB entries)

8. Domain d2wnna_: 2wnn A: [169477]
   automated match to d1hl2a_
   complexed with 1pe, na

Details for d2wnna_

PDB Entry: 2wnn, 1.65 Å

PDB Description: structure of wild type e. coli n-acetylneuraminic acid lyase in complex with pyruvate in space group p21

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wnna_:

Sequence; same for both SEQRES and ATOM records:

>d2wnna_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hhhhatnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqsls
ereqvleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfee
hcdhyraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqi
rrehpdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqt
ecnkvidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlm

Timeline for d2wnna_:

• d2wnna_ first appeared in SCOPe 2.01
  
• d2wnna_ appears in SCOPe 2.03
  
• d2wnna_ appears in the current release, SCOPe 2.08, called d2wnna1