Lineage for d2wmye_ (2wmy E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482762Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2482763Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2482836Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2482837Protein automated matches [190574] (20 species)
    not a true protein
  7. 2482867Species Escherichia coli [TaxId:562] [189034] (2 PDB entries)
  8. 2482872Domain d2wmye_: 2wmy E: [169469]
    automated match to d1bvha_
    complexed with ni, so4

Details for d2wmye_

PDB Entry: 2wmy (more details), 2.21 Å

PDB Description: crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
PDB Compounds: (E:) putative acid phosphatase wzb

SCOPe Domain Sequences for d2wmye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmye_ c.44.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]}
mfdsilvictgnicrspigerllrrllpskkinsagvgalvdhtadesairvaeknglcl
kghrgtkftsalarqydlllvmeyshleqisriapeargktmlfghwldskeipdpyrms
deafdsvyqlleqaskrwaeklg

SCOPe Domain Coordinates for d2wmye_:

Click to download the PDB-style file with coordinates for d2wmye_.
(The format of our PDB-style files is described here.)

Timeline for d2wmye_: