Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (20 species) not a true protein |
Species Escherichia coli [TaxId:562] [189034] (2 PDB entries) |
Domain d2wmye_: 2wmy E: [169469] automated match to d1bvha_ complexed with ni, so4 |
PDB Entry: 2wmy (more details), 2.21 Å
SCOPe Domain Sequences for d2wmye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wmye_ c.44.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mfdsilvictgnicrspigerllrrllpskkinsagvgalvdhtadesairvaeknglcl kghrgtkftsalarqydlllvmeyshleqisriapeargktmlfghwldskeipdpyrms deafdsvyqlleqaskrwaeklg
Timeline for d2wmye_: