SCOPe 2.08: Domain d2wevd2: 2wev D:310-432

Lineage for d2wevd2 (2wev D:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d2wevd2: 2wev D:310-432 [169287]
   Other proteins in same PDB: d2weva_, d2wevc_
   automated match to d1jsub2
   complexed with ck7

Details for d2wevd2

PDB Entry: 2wev, 2.3 Å

PDB Description: truncation and optimisation of peptide inhibitors of cdk2, cyclin a through structure guided design

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2wevd2:

Sequence; same for both SEQRES and ATOM records:

>d2wevd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d2wevd2:

• d2wevd2 first appeared in SCOPe 2.01
  
• d2wevd2 appears in SCOPe 2.07