| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
| Domain d2wevb1: 2wev B:175-309 [169283] Other proteins in same PDB: d2weva_, d2wevc_ automated match to d1jsub1 complexed with ck7 |
PDB Entry: 2wev (more details), 2.3 Å
SCOPe Domain Sequences for d2wevb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wevb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap
Timeline for d2wevb1:
View in 3DDomains from other chains: (mouse over for more information) d2weva_, d2wevc_, d2wevd1, d2wevd2 |