![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries) contains additional alpha+beta and Zn-binding domains in the C-terminal extension |
![]() | Domain d1qu2a1: 1qu2 A:645-917 [16925] Other proteins in same PDB: d1qu2a2, d1qu2a3 protein/RNA complex; complexed with k, mg, mrc, zn |
PDB Entry: 1qu2 (more details), 2.2 Å
SCOPe Domain Sequences for d1qu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu2a1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdiviehadge kcercwnysedlgavdelthlcprcqqvvkslv
Timeline for d1qu2a1: