Lineage for d1qu2a1 (1qu2 A:645-917)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991851Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 protein domains)
  6. 1991866Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 1991867Species Staphylococcus aureus [TaxId:1280] [47330] (3 PDB entries)
    contains additional alpha+beta and Zn-binding domains in the C-terminal extension
  8. 1991869Domain d1qu2a1: 1qu2 A:645-917 [16925]
    Other proteins in same PDB: d1qu2a2, d1qu2a3
    protein/RNA complex; complexed with k, mg, mrc, zn

Details for d1qu2a1

PDB Entry: 1qu2 (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1qu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu2a1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
yrkirntlrfmlgnindfnpdtdsipesellevdryllnrlreftastinnyenfdylni
yqevqnfinvelsnfyldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhta
eevwshtphvkeesvhladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigks
leakvtiasndkfnasefltsfdalhqlfivsqvkvvdklddqatayehgdiviehadge
kcercwnysedlgavdelthlcprcqqvvkslv

SCOPe Domain Coordinates for d1qu2a1:

Click to download the PDB-style file with coordinates for d1qu2a1.
(The format of our PDB-style files is described here.)

Timeline for d1qu2a1: