Lineage for d2wcvg_ (2wcv G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923177Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2923178Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2923205Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 2923206Protein automated matches [190962] (7 species)
    not a true protein
  7. 2923218Species Escherichia coli [TaxId:562] [189112] (1 PDB entry)
  8. 2923225Domain d2wcvg_: 2wcv G: [169237]
    automated match to d2ob5a1
    complexed with fuc

Details for d2wcvg_

PDB Entry: 2wcv (more details), 1.9 Å

PDB Description: crystal structure of bacterial fucu
PDB Compounds: (G:) l-fucose mutarotase

SCOPe Domain Sequences for d2wcvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcvg_ c.133.1.0 (G:) automated matches {Escherichia coli [TaxId: 562]}
mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
vitgerakygnillkkgvtp

SCOPe Domain Coordinates for d2wcvg_:

Click to download the PDB-style file with coordinates for d2wcvg_.
(The format of our PDB-style files is described here.)

Timeline for d2wcvg_: