PDB entry 2wcv

View 2wcv on RCSB PDB site
Description: crystal structure of bacterial fucu
Class: isomerase
Keywords: ribose, pyranase, isomerase, fucose metabolism
Deposited on 2009-03-17, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcva_
  • Chain 'B':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvb_
  • Chain 'C':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvc_
  • Chain 'D':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvd_
  • Chain 'E':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcve_
  • Chain 'F':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvf_
  • Chain 'G':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvg_
  • Chain 'H':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvh_
  • Chain 'I':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvi_
  • Chain 'J':
    Compound: l-fucose mutarotase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wcvj_
  • Heterogens: FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wcvA (A:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcvA (A:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslpcpdiirinrfafyeraqkafaivi
    tgerakygnillkkgvtp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvB (B:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wcvC (C:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcvC (C:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalsapcpdiirinrfafyeraqkafaivi
    tgerakygnillkkgvtp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvD (D:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wcvE (E:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wcvE (E:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslapcpdiirinrfafyeraqkafaiv
    itgerakygnillkkgvtp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvF (F:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvG (G:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvH (H:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvI (I:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wcvJ (J:)
    mlktisplispellkvlaemghgdeiifsdahfpahsmgpqviradgllvsdllqaiipl
    feldsyapplvmmaavegdtldpeverryrnalslqapcpdiirinrfafyeraqkafai
    vitgerakygnillkkgvtp