SCOP 1.71: Domain d2rig__: 2rig -

Lineage for d2rig__ (2rig -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47321] (1 PDB entry)

8. Domain d2rig__: 2rig - [16921]
   CA-atoms only

Details for d2rig__

PDB Entry: 2rig, 2.3 Å

PDB Description: crystal structure of recombinant rabbit interferon-gamma at 2.7-angstroms resolution

SCOP Domain Sequences for d2rig__:

Sequence; same for both SEQRES and ATOM records:

>d2rig__ a.26.1.3 (-) Interferon-gamma {Rabbit (Oryctolagus cuniculus)}
qdtltretehlkaylkantsdvanggplflnilrnwkeesdnkiiqsqivsfyfklfdnl
kdhevikksmesikedifvkffnsnltkmddfqnltrisvddrlvqrkavselsnvlnf

Timeline for d2rig__:

• d2rig__ first appeared (with stable ids) in SCOP 1.55
  
• d2rig__ appears in SCOP 1.69
  
• d2rig__ is called d2riga_ in SCOP 1.73
  
• d2rig__ appears in the current release, SCOPe 2.08, called d2riga_