SCOPe 2.08: Domain d2riga_: 2rig A:

Lineage for d2riga_ (2rig A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47321] (1 PDB entry)

8. Domain d2riga_: 2rig A: [16921]
   CA-atoms only

Details for d2riga_

PDB Entry: 2rig, 2.3 Å

PDB Description: crystal structure of recombinant rabbit interferon-gamma at 2.7-angstroms resolution

PDB Compounds: (A:) interferon-gamma

SCOPe Domain Sequences for d2riga_:

Sequence; same for both SEQRES and ATOM records:

>d2riga_ a.26.1.3 (A:) Interferon-gamma {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qdtltretehlkaylkantsdvanggplflnilrnwkeesdnkiiqsqivsfyfklfdnl
kdhevikksmesikedifvkffnsnltkmddfqnltrisvddrlvqrkavselsnvlnf

Timeline for d2riga_:

• d2riga_ first appeared (with stable ids) in SCOP 1.55, called d2rig__
  
• d2riga_ appears in SCOPe 2.07