SCOPe 2.01: Domain d2wc4c_: 2wc4 C:

Lineage for d2wc4c_ (2wc4 C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein automated matches [190245] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)

8. Domain d2wc4c_: 2wc4 C: [169204]
   automated match to d1od0b_
   complexed with acy, amf, ca, edo

Details for d2wc4c_

PDB Entry: 2wc4, 1.7 Å

PDB Description: Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine

PDB Compounds: (C:) beta-glucosidase a

SCOPe Domain Sequences for d2wc4c_:

Sequence; same for both SEQRES and ATOM records:

>d2wc4c_ c.1.8.4 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

Timeline for d2wc4c_:

• d2wc4c_ is new in SCOPe 2.01-stable
  
• d2wc4c_ appears in SCOPe 2.02
  
• d2wc4c_ appears in the current release, SCOPe 2.08