Class g: Small proteins [56992] (98 folds) |
Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family) duplication: contains two Zn-binding domains of similar fold automatically mapped to Pfam PF03728 |
Family g.51.1.1: Zn-binding domains of ADDBP [57918] (3 proteins) |
Protein Second Zn-domain of early E2A DNA-binding protein, ADDBP [57921] (1 species) Single-stranded DNA-binding protein |
Species Human adenovirus type 5 [TaxId:28285] [57922] (4 PDB entries) |
Domain d2wb0x3: 2wb0 X:386-529 [169166] Other proteins in same PDB: d2wb0x1, d2wb0x2 complexed with zn |
PDB Entry: 2wb0 (more details)
SCOPe Domain Sequences for d2wb0x3:
Sequence, based on SEQRES records: (download)
>d2wb0x3 g.51.1.1 (X:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal ivfqccnpvyrnsraqgggpncdfkisapdllnalvmvrslwsenftelprmvvpefkws tkhqyrnvslpvahsdarqnpfdf
>d2wb0x3 g.51.1.1 (X:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]} ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal ivfqccnpvygpncdfkisapdllnalvmvrslwsenftelprmvvpefkwstkhqyrnv slpvahsdarqnpfdf
Timeline for d2wb0x3: