SCOPe 2.08: Domain d2wb0x3: 2wb0 X:386-529

Lineage for d2wb0x3 (2wb0 X:386-529)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family)
   duplication: contains two Zn-binding domains of similar fold
   automatically mapped to Pfam PF03728

5. Family g.51.1.1: Zn-binding domains of ADDBP [57918] (3 proteins)

6. Protein Second Zn-domain of early E2A DNA-binding protein, ADDBP [57921] (1 species)
   Single-stranded DNA-binding protein

7. Species Human adenovirus type 5 [TaxId:28285] [57922] (4 PDB entries)

8. Domain d2wb0x3: 2wb0 X:386-529 [169166]
   Other proteins in same PDB: d2wb0x1, d2wb0x2
   complexed with zn

Details for d2wb0x3

PDB Entry: 2wb0, 1.95 Å

PDB Description: 2.1 resolution structure of the c-terminal domain of the human adenovirus 5 ssdna binding protein

PDB Compounds: (X:) e2a DNA-binding protein

SCOPe Domain Sequences for d2wb0x3:

Sequence, based on SEQRES records:

>d2wb0x3 g.51.1.1 (X:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal
ivfqccnpvyrnsraqgggpncdfkisapdllnalvmvrslwsenftelprmvvpefkws
tkhqyrnvslpvahsdarqnpfdf

Sequence, based on observed residues (ATOM records):

>d2wb0x3 g.51.1.1 (X:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5 [TaxId: 28285]}
ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal
ivfqccnpvygpncdfkisapdllnalvmvrslwsenftelprmvvpefkwstkhqyrnv
slpvahsdarqnpfdf

Timeline for d2wb0x3:

• d2wb0x3 first appeared in SCOPe 2.01
  
• d2wb0x3 appears in SCOPe 2.07