Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [188951] (1 PDB entry) |
Domain d2waga1: 2wag A:11-218 [169160] Other proteins in same PDB: d2waga2 automated match to d1jfxa_ complexed with 15p, gol, mg, so4 |
PDB Entry: 2wag (more details), 1.4 Å
SCOPe Domain Sequences for d2waga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2waga1 c.1.8.0 (A:11-218) automated matches {Bacillus anthracis [TaxId: 198094]} mdryeikgvdvasyqgdidwrelekqnmkfafikategsafvdkyfsknwtnanktsmrv gayhffsfdskgetqaeqfirnvpkykqalppvidvefyankkdnppkredvtkelsvmi emlekhygkkvilyatqeaydlyikdaypqcdiwirsvltkpslsderkwtfwqytnrgk lsgyngkekyidlnvfygneeefenygm
Timeline for d2waga1: