SCOPe 2.06: Domain d2waga1: 2wag A:11-218

Lineage for d2waga1 (2wag A:11-218)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [188951] (1 PDB entry)

8. Domain d2waga1: 2wag A:11-218 [169160]
   Other proteins in same PDB: d2waga2
   automated match to d1jfxa_
   complexed with 15p, gol, mg, so4

Details for d2waga1

PDB Entry: 2wag, 1.4 Å

PDB Description: the structure of a family 25 glycosyl hydrolase from bacillus anthracis.

PDB Compounds: (A:) lysozyme, putative

SCOPe Domain Sequences for d2waga1:

Sequence; same for both SEQRES and ATOM records:

>d2waga1 c.1.8.0 (A:11-218) automated matches {Bacillus anthracis [TaxId: 198094]}
mdryeikgvdvasyqgdidwrelekqnmkfafikategsafvdkyfsknwtnanktsmrv
gayhffsfdskgetqaeqfirnvpkykqalppvidvefyankkdnppkredvtkelsvmi
emlekhygkkvilyatqeaydlyikdaypqcdiwirsvltkpslsderkwtfwqytnrgk
lsgyngkekyidlnvfygneeefenygm

Timeline for d2waga1:

• d2waga1 first appeared in SCOPe 2.01, called d2waga_
  
• d2waga1 was called d2waga_ in SCOPe 2.05
  
• d2waga1 appears in SCOPe 2.07
  
• d2waga1 appears in the current release, SCOPe 2.08