SCOPe 2.05: Domain d2waga_: 2wag A:

Lineage for d2waga_ (2wag A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [188951] (1 PDB entry)

8. Domain d2waga_: 2wag A: [169160]
   automated match to d1jfxa_
   complexed with 15p, gol, mg, so4

Details for d2waga_

PDB Entry: 2wag, 1.4 Å

PDB Description: the structure of a family 25 glycosyl hydrolase from bacillus anthracis.

PDB Compounds: (A:) lysozyme, putative

SCOPe Domain Sequences for d2waga_:

Sequence; same for both SEQRES and ATOM records:

>d2waga_ c.1.8.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
gsshhhhhhmdryeikgvdvasyqgdidwrelekqnmkfafikategsafvdkyfsknwt
nanktsmrvgayhffsfdskgetqaeqfirnvpkykqalppvidvefyankkdnppkred
vtkelsvmiemlekhygkkvilyatqeaydlyikdaypqcdiwirsvltkpslsderkwt
fwqytnrgklsgyngkekyidlnvfygneeefenygm

Timeline for d2waga_:

• d2waga_ first appeared in SCOPe 2.01
  
• d2waga_ appears in SCOPe 2.04
  
• d2waga_ is called d2waga1 in SCOPe 2.06
  
• d2waga_ appears in the current release, SCOPe 2.08, called d2waga1