SCOPe 2.06: Domain d2w9ga_: 2w9g A:

Lineage for d2w9ga_ (2w9g A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188848] (9 PDB entries)

8. Domain d2w9ga_: 2w9g A: [169118]
   automated match to d1dhja_
   complexed with ndp, top

Details for d2w9ga_

PDB Entry: 2w9g, 1.95 Å

PDB Description: wild-type staphylococcus aureus dhfr in complex with nadph and trimethoprim

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2w9ga_:

Sequence; same for both SEQRES and ATOM records:

>d2w9ga_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkk

Timeline for d2w9ga_:

• d2w9ga_ first appeared in SCOPe 2.01
  
• d2w9ga_ appears in SCOPe 2.05
  
• d2w9ga_ appears in SCOPe 2.07
  
• d2w9ga_ appears in the current release, SCOPe 2.08