Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (21 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [188848] (9 PDB entries) |
Domain d2w9ga_: 2w9g A: [169118] automated match to d1dhja_ complexed with ndp, top |
PDB Entry: 2w9g (more details), 1.95 Å
SCOPe Domain Sequences for d2w9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9ga_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlirkk
Timeline for d2w9ga_: