Lineage for d2w9ga_ (2w9g A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004553Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1004554Protein automated matches [190777] (8 species)
    not a true protein
  7. 1004622Species Staphylococcus aureus [TaxId:1280] [188848] (5 PDB entries)
  8. 1004630Domain d2w9ga_: 2w9g A: [169118]
    automated match to d1dhja_
    complexed with ndp, top

Details for d2w9ga_

PDB Entry: 2w9g (more details), 1.95 Å

PDB Description: wild-type staphylococcus aureus dhfr in complex with nadph and trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2w9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9ga_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkk

SCOPe Domain Coordinates for d2w9ga_:

Click to download the PDB-style file with coordinates for d2w9ga_.
(The format of our PDB-style files is described here.)

Timeline for d2w9ga_: