Lineage for d1fyhd2 (1fyh D:201-324)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441656Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 441657Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 441813Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 441832Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 441840Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 441844Domain d1fyhd2: 1fyh D:201-324 [16910]
    Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2
    a single-chain variant

Details for d1fyhd2

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

SCOP Domain Sequences for d1fyhd2:

Sequence, based on SEQRES records: (download)

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens)}
sgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spaa

Sequence, based on observed residues (ATOM records): (download)

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens)}
sgefvkeaenlkkyfngtlflgilknwkeesdrkimqsqivsfyfklfknfkddqsiqks
vetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa

SCOP Domain Coordinates for d1fyhd2:

Click to download the PDB-style file with coordinates for d1fyhd2.
(The format of our PDB-style files is described here.)

Timeline for d1fyhd2: