Lineage for d1fyhd2 (1fyh D:201-324)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2754Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)
  6. 2773Protein Interferon-gamma [47318] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. Domain d1fyhd2: 1fyh D:201-324 [16910]
    Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2

Details for d1fyhd2

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor
PDB Compounds: (D:)

SCOP Domain Sequences for d1fyhd2:

Sequence, based on SEQRES records: (download)

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens)}
sgefvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spaa

Sequence, based on observed residues (ATOM records): (download)

>d1fyhd2 a.26.1.3 (D:201-324) Interferon-gamma {Human (Homo sapiens)}
sgefvkeaenlkkyfngtlflgilknwkeesdrkimqsqivsfyfklfknfkddqsiqks
vetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmaelspaa

SCOP Domain Coordinates for d1fyhd2 are not available.

Timeline for d1fyhd2:

Domains from same chain:
(mouse over for more information)
d1fyhd1
Domains from other chains:
(mouse over for more information)
d1fyha1, d1fyha2, d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2