Lineage for d2w5ub_ (2w5u B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838448Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1838560Protein automated matches [190443] (4 species)
    not a true protein
  7. 1838576Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries)
  8. 1838579Domain d2w5ub_: 2w5u B: [169075]
    automated match to d1fuea_
    complexed with fmn, ic3

Details for d2w5ub_

PDB Entry: 2w5u (more details), 2.62 Å

PDB Description: flavodoxin from helicobacter pylori in complex with the c3 inhibitor
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d2w5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w5ub_ c.23.5.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa

SCOPe Domain Coordinates for d2w5ub_:

Click to download the PDB-style file with coordinates for d2w5ub_.
(The format of our PDB-style files is described here.)

Timeline for d2w5ub_: