Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein automated matches [190443] (6 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries) |
Domain d2w5ub_: 2w5u B: [169075] automated match to d1fuea_ complexed with fmn, ic3 |
PDB Entry: 2w5u (more details), 2.62 Å
SCOPe Domain Sequences for d2w5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w5ub_ c.23.5.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]} gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
Timeline for d2w5ub_: