| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains) binds FMN |
| Protein automated matches [190443] (3 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [187348] (2 PDB entries) |
| Domain d2w5ub_: 2w5u B: [169075] automated match to d1fuea_ complexed with fmn, ic3 |
| PDB Entry: 2w5u (more details) PDB Description: flavodoxin from helicobacter pylori in complex with the c3 inhibitor
PDB Compounds: (B:) flavodoxinSCOP Domain Sequences for d2w5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w5ub_ c.23.5.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
SCOP Domain Coordinates for d2w5ub_:
Click to download the PDB-style file with coordinates for d2w5ub_. (The format of our PDB-style files is described here.)
Timeline for d2w5ub_:
d2w5ub_ appears in SCOP 1.75A | d2w5ub_ (click for larger image) d2w5ub_ in context of chain d2w5ub_ in context of PDB Domains from other chains: d2w5ua_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |