Lineage for d1fyha1 (1fyh A:0-124)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536620Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 536621Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 536777Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 536796Protein Interferon-gamma [47318] (3 species)
    intertwined dimer
  7. 536804Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
  8. 536805Domain d1fyha1: 1fyh A:0-124 [16907]
    Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2

Details for d1fyha1

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

SCOP Domain Sequences for d1fyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyha1 a.26.1.3 (A:0-124) Interferon-gamma {Human (Homo sapiens)}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
lganv

SCOP Domain Coordinates for d1fyha1:

Click to download the PDB-style file with coordinates for d1fyha1.
(The format of our PDB-style files is described here.)

Timeline for d1fyha1: