SCOP 1.71: Domain d1fyha1: 1fyh A:0-124

Lineage for d1fyha1 (1fyh A:0-124)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)

8. Domain d1fyha1: 1fyh A:0-124 [16907]
   Other proteins in same PDB: d1fyhb1, d1fyhb2, d1fyhe1, d1fyhe2

Details for d1fyha1

PDB Entry: 1fyh, 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

SCOP Domain Sequences for d1fyha1:

Sequence; same for both SEQRES and ATOM records:

>d1fyha1 a.26.1.3 (A:0-124) Interferon-gamma {Human (Homo sapiens)}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
lganv

Timeline for d1fyha1:

• d1fyha1 first appeared (with stable ids) in SCOP 1.55
  
• d1fyha1 appears in SCOP 1.69
  
• d1fyha1 appears in SCOP 1.73
  
• d1fyha1 appears in the current release, SCOPe 2.08