Lineage for d1fyhb2 (1fyh B:110-223)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550995Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 550996Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 550998Domain d1fyhb2: 1fyh B:110-223 [22056]
    Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2

Details for d1fyhb2

PDB Entry: 1fyh (more details), 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

SCOP Domain Sequences for d1fyhb2:

Sequence, based on SEQRES records: (download)

>d1fyhb2 b.1.2.1 (B:110-223) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifn

Sequence, based on observed residues (ATOM records): (download)

>d1fyhb2 b.1.2.1 (B:110-223) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvettcyirvynvyvrmngseiqykiltqkeddcde
iqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifn

SCOP Domain Coordinates for d1fyhb2:

Click to download the PDB-style file with coordinates for d1fyhb2.
(The format of our PDB-style files is described here.)

Timeline for d1fyhb2: