SCOPe 2.04: Domain d2w3va_: 2w3v A:

Lineage for d2w3va_ (2w3v A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (7 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1764] [189124] (2 PDB entries)

8. Domain d2w3va_: 2w3v A: [169047]
   automated match to d1df7a_
   complexed with ndp, top

Details for d2w3va_

PDB Entry: 2w3v, 1.89 Å

PDB Description: mycobacterium avium dihydrofolate reductase complexed with nadph and trimethoprim

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2w3va_:

Sequence; same for both SEQRES and ATOM records:

>d2w3va_ c.71.1.1 (A:) automated matches {Mycobacterium avium [TaxId: 1764]}
raevglvwaqstsgvigrggdipwsvpedltrfkevtmghtvimgrrtweslpakvrplp
grrnvvvsrrpdfvaegarvagsleaalayagsdpapwviggaqiyllalphatrcevte
ieidlrrddddalapalddswvgetgewlasrsglryrfhsyrrd

Timeline for d2w3va_:

• d2w3va_ first appeared in SCOPe 2.01
  
• d2w3va_ appears in SCOPe 2.03
  
• d2w3va_ appears in SCOPe 2.05
  
• d2w3va_ appears in the current release, SCOPe 2.08