Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein automated matches [190514] (8 species) not a true protein |
Species Mycobacterium avium [TaxId:1764] [189124] (2 PDB entries) |
Domain d2w3va_: 2w3v A: [169047] automated match to d1df7a_ complexed with ndp, top |
PDB Entry: 2w3v (more details), 1.89 Å
SCOPe Domain Sequences for d2w3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w3va_ c.71.1.1 (A:) automated matches {Mycobacterium avium [TaxId: 1764]} raevglvwaqstsgvigrggdipwsvpedltrfkevtmghtvimgrrtweslpakvrplp grrnvvvsrrpdfvaegarvagsleaalayagsdpapwviggaqiyllalphatrcevte ieidlrrddddalapalddswvgetgewlasrsglryrfhsyrrd
Timeline for d2w3va_: