Lineage for d2w3va_ (2w3v A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384491Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1384814Protein automated matches [190514] (8 species)
    not a true protein
  7. 1384829Species Mycobacterium avium [TaxId:1764] [189124] (2 PDB entries)
  8. 1384831Domain d2w3va_: 2w3v A: [169047]
    automated match to d1df7a_
    complexed with ndp, top

Details for d2w3va_

PDB Entry: 2w3v (more details), 1.89 Å

PDB Description: mycobacterium avium dihydrofolate reductase complexed with nadph and trimethoprim
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2w3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3va_ c.71.1.1 (A:) automated matches {Mycobacterium avium [TaxId: 1764]}
raevglvwaqstsgvigrggdipwsvpedltrfkevtmghtvimgrrtweslpakvrplp
grrnvvvsrrpdfvaegarvagsleaalayagsdpapwviggaqiyllalphatrcevte
ieidlrrddddalapalddswvgetgewlasrsglryrfhsyrrd

SCOPe Domain Coordinates for d2w3va_:

Click to download the PDB-style file with coordinates for d2w3va_.
(The format of our PDB-style files is described here.)

Timeline for d2w3va_: