SCOPe 2.08: Domain d2w2vd_: 2w2v D:

Lineage for d2w2vd_ (2w2v D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2w2vd_: 2w2v D: [169032]
   automated match to d1ds6a_
   complexed with gtp

Details for d2w2vd_

PDB Entry: 2w2v, 2 Å

PDB Description: rac2 (g12v) in complex with gtpgs

PDB Compounds: (D:) ras-related c3 botulinum toxin substrate 2

SCOPe Domain Sequences for d2w2vd_:

Sequence, based on SEQRES records:

>d2w2vd_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlr
ddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl

Sequence, based on observed residues (ATOM records):

>d2w2vd_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdvavgktcllisyttnafpgeyiptvfdnysanvmvpvnlglwdtagqed
ydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlrddk
dtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavl

Timeline for d2w2vd_:

• d2w2vd_ first appeared in SCOPe 2.01
  
• d2w2vd_ appears in SCOPe 2.07