Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (51 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [188720] (2 PDB entries) |
Domain d2w11a1: 2w11 A:1-201 [168994] Other proteins in same PDB: d2w11a2, d2w11b2 automated match to d1juda_ complexed with 2op |
PDB Entry: 2w11 (more details), 1.9 Å
SCOPe Domain Sequences for d2w11a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w11a1 c.108.1.0 (A:1-201) automated matches {Sulfolobus tokodaii [TaxId: 111955]} miilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgee skfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifs aesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpig gkpdvivndfkelyewilryk
Timeline for d2w11a1: