Lineage for d2w11a1 (2w11 A:1-201)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920666Species Sulfolobus tokodaii [TaxId:111955] [188720] (2 PDB entries)
  8. 2920667Domain d2w11a1: 2w11 A:1-201 [168994]
    Other proteins in same PDB: d2w11a2, d2w11b2
    automated match to d1juda_
    complexed with 2op

Details for d2w11a1

PDB Entry: 2w11 (more details), 1.9 Å

PDB Description: structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
PDB Compounds: (A:) 2-haloalkanoic acid dehalogenase

SCOPe Domain Sequences for d2w11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w11a1 c.108.1.0 (A:1-201) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
miilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgee
skfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifs
aesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpig
gkpdvivndfkelyewilryk

SCOPe Domain Coordinates for d2w11a1:

Click to download the PDB-style file with coordinates for d2w11a1.
(The format of our PDB-style files is described here.)

Timeline for d2w11a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w11a2