SCOPe 2.08: Domain d2vzxe1: 2vzx E:3-225

Lineage for d2vzxe1 (2vzx E:3-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry)

8. Domain d2vzxe1: 2vzx E:3-225 [168963]
   Other proteins in same PDB: d2vzxb2, d2vzxc2, d2vzxe2, d2vzxh2
   automated match to d1mova_
   complexed with gol, pg4

Details for d2vzxe1

PDB Entry: 2vzx, 2 Å

PDB Description: structural and spectroscopic characterization of photoconverting fluorescent protein dendra2

PDB Compounds: (E:) Green fluorescent protein

SCOPe Domain Sequences for d2vzxe1:

Sequence; same for both SEQRES and ATOM records:

>d2vzxe1 d.22.1.1 (E:3-225) automated matches {Dendronephthya sp. [TaxId: 191210]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttavh
ygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfkg
tnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv
vqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvw

Timeline for d2vzxe1:

• d2vzxe1 first appeared in SCOPe 2.01, called d2vzxe_
  
• d2vzxe1 appears in SCOPe 2.07