Lineage for d2vzxf_ (2vzx F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940379Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry)
  8. 2940385Domain d2vzxf_: 2vzx F: [168964]
    Other proteins in same PDB: d2vzxb2, d2vzxc2, d2vzxe2, d2vzxh2
    automated match to d1mova_
    complexed with gol, pg4

Details for d2vzxf_

PDB Entry: 2vzx (more details), 2 Å

PDB Description: structural and spectroscopic characterization of photoconverting fluorescent protein dendra2
PDB Compounds: (F:) Green fluorescent protein

SCOPe Domain Sequences for d2vzxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzxf_ d.22.1.1 (F:) automated matches {Dendronephthya sp. [TaxId: 191210]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttavh
ygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfkg
tnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv
vqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvw

SCOPe Domain Coordinates for d2vzxf_:

Click to download the PDB-style file with coordinates for d2vzxf_.
(The format of our PDB-style files is described here.)

Timeline for d2vzxf_: