Lineage for d2vz6b_ (2vz6 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1674960Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)
  8. 1675150Domain d2vz6b_: 2vz6 B: [168958]
    automated match to d1a06a_
    complexed with fef, pgo

Details for d2vz6b_

PDB Entry: 2vz6 (more details), 2.3 Å

PDB Description: structure of human calcium calmodulin dependent protein kinase type ii alpha (camk2a) in complex with indirubin e804
PDB Compounds: (B:) calcium calmodulin dependent protein kinase type II alpha chain

SCOPe Domain Sequences for d2vz6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz6b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmyqlfeelgkgafsvvrrcvkvlagqeyaakiintkklsardhqklerearicrl
lkhpnivrlhdsiseeghhylifdlvtggelfedivareyyseadashciqqileavlhc
hqmgvvhrdlkpenlllasklkgaavkladfglaievegeqqawfgfagtpgylspevlr
kdpygkpvdlwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakd
linkmltinpskritaaealkhpwishrstvascmhrqetvdclkkfnarrklk

SCOPe Domain Coordinates for d2vz6b_:

Click to download the PDB-style file with coordinates for d2vz6b_.
(The format of our PDB-style files is described here.)

Timeline for d2vz6b_: