Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
Protein automated matches [190614] (15 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries) |
Domain d2vwsc_: 2vws C: [168888] automated match to d1dxea_ complexed with gol, po4 |
PDB Entry: 2vws (more details), 1.39 Å
SCOPe Domain Sequences for d2vwsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwsc_ c.1.12.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt mlysdaldqrlamfks
Timeline for d2vwsc_: