Lineage for d2vwsc_ (2vws C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973648Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 973934Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 973935Protein automated matches [190614] (3 species)
    not a true protein
  7. 973938Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries)
  8. 973941Domain d2vwsc_: 2vws C: [168888]
    automated match to d1dxea_
    complexed with gol, po4

Details for d2vwsc_

PDB Entry: 2vws (more details), 1.39 Å

PDB Description: crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12
PDB Compounds: (C:) yfau, 2-keto-3-deoxy sugar aldolase

SCOPe Domain Sequences for d2vwsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwsc_ c.1.12.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq
lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger
gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl
saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt
mlysdaldqrlamfks

SCOPe Domain Coordinates for d2vwsc_:

Click to download the PDB-style file with coordinates for d2vwsc_.
(The format of our PDB-style files is described here.)

Timeline for d2vwsc_: