Lineage for d2vv8c_ (2vv8 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210819Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)
  6. 2210832Protein Histidine kinase FixL heme domain [55790] (2 species)
  7. 2210833Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries)
    Uniprot P23222 152-270
  8. 2210840Domain d2vv8c_: 2vv8 C: [168846]
    automated match to d1drma_
    complexed with cl, cmo, hem, na

Details for d2vv8c_

PDB Entry: 2vv8 (more details), 1.61 Å

PDB Description: co-bound structure of bjfixlh
PDB Compounds: (C:) sensor protein fixl

SCOPe Domain Sequences for d2vv8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vv8c_ d.110.3.2 (C:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlte

SCOPe Domain Coordinates for d2vv8c_:

Click to download the PDB-style file with coordinates for d2vv8c_.
(The format of our PDB-style files is described here.)

Timeline for d2vv8c_: