SCOPe 2.05: Domain d2vv8c_: 2vv8 C:

Lineage for d2vv8c_ (2vv8 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins)

6. Protein Histidine kinase FixL heme domain [55790] (2 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [55792] (18 PDB entries)
   Uniprot P23222 152-270

8. Domain d2vv8c_: 2vv8 C: [168846]
   automated match to d1drma_
   complexed with cl, cmo, hem, na

Details for d2vv8c_

PDB Entry: 2vv8, 1.61 Å

PDB Description: co-bound structure of bjfixlh

PDB Compounds: (C:) sensor protein fixl

SCOPe Domain Sequences for d2vv8c_:

Sequence; same for both SEQRES and ATOM records:

>d2vv8c_ d.110.3.2 (C:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]}
pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlte

Timeline for d2vv8c_:

• d2vv8c_ first appeared in SCOPe 2.01
  
• d2vv8c_ appears in SCOPe 2.04
  
• d2vv8c_ appears in SCOPe 2.06
  
• d2vv8c_ appears in the current release, SCOPe 2.08