Lineage for d2vudc_ (2vud C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821276Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2821277Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2821278Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2821332Protein automated matches [190094] (4 species)
    not a true protein
  7. 2821366Species Pseudomonas aeruginosa [TaxId:287] [186815] (11 PDB entries)
  8. 2821401Domain d2vudc_: 2vud C: [168834]
    automated match to d1gzta_
    complexed with ca, fuc, lz0, so4

Details for d2vudc_

PDB Entry: 2vud (more details), 1.7 Å

PDB Description: pa-iil lectin from pseudomonas aeruginosa complexed with fucose- derived glycomimetics
PDB Compounds: (C:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2vudc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vudc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2vudc_:

Click to download the PDB-style file with coordinates for d2vudc_.
(The format of our PDB-style files is described here.)

Timeline for d2vudc_: