Lineage for d1irl__ (1irl -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.2: Short-chain cytokines [47286] (10 proteins) 
Protein Interleukin-2 (IL-2) [47301] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47302] (2 PDB entries) 
Domain d1irl__: 1irl - [16883]
Details for d1irl__
PDB Entry: 1irl (more details)
PDB Description: the solution structure of the f42a mutant of human interleukin 2
SCOP Domain Sequences for d1irl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irl__ a.26.1.2 (-) Interleukin-2 (IL-2) {Human (Homo sapiens)}
aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt
SCOP Domain Coordinates for d1irl__:
Click to download the PDB-style file with coordinates for d1irl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1irl__:
- d1irl__ first appeared (with stable ids) in SCOP 1.55
- d1irl__ appears in SCOP 1.57
- d1irl__ appears in SCOP 1.61
- d1irl__ appears in the current release, SCOPe 2.08, called d1irla_
View in 3D